Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1591-MT1626 (Rv1591, MT1626)

Recombinant Uncharacterized protein Rv1591-MT1626 (Rv1591, MT1626)

SKU:CSB-CF363697MVZ

Regular price ¥275,200 JPY
Regular price Sale price ¥275,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P0A5F3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGLSATGVLVGGLWAWIAPPIHAVVAITRAGERVHEYLGSESQNFFIAPFMLLGLLSVL AVVASALMWQWREHRGPQMVAGLSIGLTTAAAIAAGVGALVVRLRYGALDFDTVPLSRGD HALTYVTQAPPVFFARRPLQIALTLMWPAGIASLVYALLAAGTARDDLGGYPAVDPSSNA RTEALETPQAPVS

Protein Names:Recommended name: Uncharacterized protein Rv1591/MT1626

Gene Names:Ordered Locus Names:Rv1591, MT1626 ORF Names:MTCY336.13c

Expression Region:1-193

Sequence Info:full length protein

View full details