Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1362c-MT1407(Rv1362c, MT1407)

Recombinant Uncharacterized protein Rv1362c-MT1407(Rv1362c, MT1407)

SKU:CSB-CF612077MVZ

Regular price ¥279,900 JPY
Regular price Sale price ¥279,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:Q11032

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDDVRDVNTETTDATEVAEIDSAAGEAGDSATEAFDTDSATESTAQKGQRHRDLWRMQV TLKPVPVILILLMLISGGATGWLYLEQYRPDQQTDSGAARAAVAAASDGTIALLSYSPDT LDQDFATARSHLAGDFLSYYDQFTQQIVAPAAKQKSLKTTAKVVRAAVSELHPDSAVVLV FVDQSTTSKDSPNPSMAASSVMVTLAKVDGNWLITKFTPV

Protein Names:Recommended name: Uncharacterized protein Rv1362c/MT1407

Gene Names:Ordered Locus Names:Rv1362c, MT1407 ORF Names:MTCY02B10.26c

Expression Region:1-220

Sequence Info:full length protein

View full details