Gene Bio Systems
Recombinant Uncharacterized protein Rv1343c-MT1384(Rv1343c, MT1384)
Recombinant Uncharacterized protein Rv1343c-MT1384(Rv1343c, MT1384)
SKU:CSB-CF608917MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:Q11013
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAY RNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARK QNRTTA
Protein Names:Recommended name: Uncharacterized protein Rv1343c/MT1384
Gene Names:Ordered Locus Names:Rv1343c, MT1384 ORF Names:MTCY02B10.07c
Expression Region:1-126
Sequence Info:full length protein
