Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1337-MT1378 (Rv1337, MT1378)

Recombinant Uncharacterized protein Rv1337-MT1378 (Rv1337, MT1378)

SKU:CSB-CF354391MVZ

Regular price ¥274,700 JPY
Regular price Sale price ¥274,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64815

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGMTPRRKRRGGAVQITRPTGRPRTPTTQTTKRPRWVVGGTTILTFVALLYLVELIDQLS GSRLDVNGIRPLKTDGLWGVIFAPLLHANWHHLMANTIPLLVLGFLMTLAGLSRFVWATA IIWILGGLGTWLIGNVGSSCGPTDHIGASGLIFGWLAFLLVFGLFVRKGWDIVIGLVVLF VYGGILLGAMPVLGQCGGVSWQGHLSGAVAGVVAAYLLSAPERKARALKRAGARSGHPKL

Protein Names:Recommended name: Uncharacterized protein Rv1337/MT1378

Gene Names:Ordered Locus Names:Rv1337, MT1378 ORF Names:MTCY02B10.01, MTCY130.22

Expression Region:1-240

Sequence Info:full length protein

View full details