Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein pXO2-13-BXB0012-GBAA_pXO2_0012(pXO2-13, BXB0012, GBAA_pXO2_0012)

Recombinant Uncharacterized protein pXO2-13-BXB0012-GBAA_pXO2_0012(pXO2-13, BXB0012, GBAA_pXO2_0012)

SKU:CSB-CF886500BQE

Regular price ¥255,500 JPY
Regular price Sale price ¥255,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q9RN19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVIDIANRRRIYFEMKQQELRASILMTVAGFIIAFAILVFQISFELGHLYHYIVTFAFL TYLSLHLYSNNKLARKIEKKQQGY

Protein Names:Recommended name: Uncharacterized protein pXO2-13/BXB0012/GBAA_pXO2_0012

Gene Names:Ordered Locus Names:pXO2-13, BXB0012, GBAA_pXO2_0012

Expression Region:1-84

Sequence Info:full length protein

View full details