Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein ML1177 (ML1177)

Recombinant Uncharacterized protein ML1177 (ML1177)

SKU:CSB-CF346918MVN

Regular price ¥227,900 JPY
Regular price Sale price ¥227,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:P54134

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN HNRTTT

Protein Names:Recommended name: Uncharacterized protein ML1177

Gene Names:Ordered Locus Names:ML1177 ORF Names:B1549_F3_106, MLCB1701.03c

Expression Region:1-126

Sequence Info:full length protein

View full details