Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Mb1843c (Mb1843c)

Recombinant Uncharacterized protein Mb1843c (Mb1843c)

SKU:CSB-CF353815MVH

Regular price ¥265,100 JPY
Regular price Sale price ¥265,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P64890

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGA IAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLT RRAAEDDAVNRLEGGRIVNWACN

Protein Names:Recommended name: Uncharacterized protein Mb1843c

Gene Names:Ordered Locus Names:Mb1843c

Expression Region:1-143

Sequence Info:full length protein

View full details