Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein B0228.6(B0228.6)

Recombinant Uncharacterized protein B0228.6(B0228.6)

SKU:CSB-CF600978CXY

Regular price ¥266,900 JPY
Regular price Sale price ¥266,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q09223

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSDWESTFEFVSETGQIKKRGSKTSELKQNETTDAVVVNNEKVKKRRNSKDSHIVLAKE IFAVAFFSLGMSCLLMADVSTFLWGINNPNSQQSKSIGSNIDQMSSEEFQQKVHDYMSEI QRTGRDKRPSRRFVDSARFYILSEIEPIELGTS

Protein Names:Recommended name: Uncharacterized protein B0228.6

Gene Names:ORF Names:B0228.6

Expression Region:1-153

Sequence Info:full length protein

View full details