Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein yrzS(yrzS)

Recombinant Uncharacterized membrane protein yrzS(yrzS)

SKU:CSB-CF496588BRI

Regular price ¥217,800 JPY
Regular price Sale price ¥217,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis

Uniprot NO.:C0H463

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLN LFGRMK

Protein Names:Recommended name: Uncharacterized membrane protein yrzS

Gene Names:Name:yrzS Ordered Locus Names:BSU27729

Expression Region:1-66

Sequence Info:full length protein

View full details