Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein spyM18_0408(spyM18_0408)

Recombinant Uncharacterized membrane protein spyM18_0408(spyM18_0408)

SKU:CSB-CF836908SMU

Regular price ¥281,600 JPY
Regular price Sale price ¥281,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pyogenes serotype M18

Uniprot NO.:Q8P2D4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND

Protein Names:Recommended name: Uncharacterized membrane protein spyM18_0408

Gene Names:Ordered Locus Names:spyM18_0408

Expression Region:1-229

Sequence Info:full length protein

View full details