Skip to product information
1 of 1

Gene Bio Systems

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme(pulO)

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme(pulO)

SKU:CSB-CF325776KBG

Regular price ¥280,600 JPY
Regular price Sale price ¥280,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae

Uniprot NO.:P15754

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVENIALLPEFAAQYPFLWGSFLFLSGLAFGSFFNVVIHRLPLMMEQAEGINLCFPASFC PQCREPIAWRDNIPLLGFLFLKGRSRCCGQPISPRYPLMELATGALFVLAGYLMAPGVPL LGGLILLSLLLILAAIDAQTQLLPDGLTLPLMWAGLLFNLSATYVPLAEAVVGAMAGYLS LWSVYWVFRLLSGKEALGYGDFKLLAALGAWLGWQALPQTLLLASPAA

Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Alternative name(s): Pullulanase secretion protein pulO Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prep

Gene Names:Name:pulO

Expression Region:1-228

Sequence Info:full length protein

View full details