Skip to product information
1 of 1

Gene Bio Systems

Recombinant Triticum aestivum Trypsin-alpha-amylase inhibitor CMx2

Recombinant Triticum aestivum Trypsin-alpha-amylase inhibitor CMx2

SKU:CSB-EP674868TQN

Regular price ¥191,300 JPY
Regular price Sale price ¥191,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q43691

Gene Names: N/A

Organism: Triticum aestivum (Wheat)

AA Sequence: FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLLQDMSRCKKLTREFIAGIVGRE

Expression Region: 25-121aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 31.5 kDa

Alternative Name(s): ITRL-2

Relevance:

Reference: "Sharp divergence between wheat and barley at loci encoding novel members of the trypsin/alpha-amylase inhibitors family." Sanchez de la Hoz P., Castagnaro A., Carbonero P. Plant Mol. Biol. 26:1231-1236(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details