Skip to product information
1 of 1

Gene Bio Systems

Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037)

Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037)

SKU:CSB-CF529459TPR

Regular price ¥283,800 JPY
Regular price Sale price ¥283,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Treponema pallidum (strain Nichols)

Uniprot NO.:O84000

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKIVNADGSDAICPASAACAKSIRSYQESYSLGEEIANAVTHGIGVGLSIVALVLLVVR AVHYTPADLTARYVVGFSVFGSSLIVLYLCSTLYHALPRGAKYVFGVIDHCCIYVLIAGT YTASCLTTLYGAIGWTVFGVIWGLACSGSVIYSVFGHRVRWLSLVMYIAMGWLVVFVAKP LRERLPEISFLFLVLGGVLYTVGCVFYALKRIKWTHTIWHMFVIGGSVMHFFSLYLSF

Protein Names:Recommended name: UPF0073 membrane protein TP_1037

Gene Names:Ordered Locus Names:TP_1037

Expression Region:1-238

Sequence Info:full length protein

View full details