Gene Bio Systems
Recombinant Treponema pallidum Uncharacterized protein TP_0707 (TP_0707)
Recombinant Treponema pallidum Uncharacterized protein TP_0707 (TP_0707)
SKU:CSB-CF525851TPR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Treponema pallidum (strain Nichols)
Uniprot NO.:O83705
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRGTPAYHAVSGVPCSACTCTQVAVQLALSWRGSMGRLKRCEVRRRPCALWAIVRVARIG ALAAMLAVLSFALGCALVYPLWALAVHRPRVFSVLSGLLYGGGAVLWGLRRVCNALSYAR VRRAGRRAAAQEPCVLVQAGEVGAMGLSSSAEVRPAQEC
Protein Names:Recommended name: Uncharacterized protein TP_0707
Gene Names:Ordered Locus Names:TP_0707
Expression Region:1-159
Sequence Info:full length protein
