Skip to product information
1 of 1

Gene Bio Systems

Recombinant Treponema pallidum Uncharacterized protein TP_0381 (TP_0381)

Recombinant Treponema pallidum Uncharacterized protein TP_0381 (TP_0381)

SKU:CSB-CF530616TPR

Regular price ¥283,400 JPY
Regular price Sale price ¥283,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Treponema pallidum (strain Nichols)

Uniprot NO.:O83396

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGAELADTGLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLAHKNLARAGVAILFLR LGLMLCGTLLDGRSWRNELPFHLCPAALISGSLYFITRRPIFFNLLYFWHFGSFVAVLYP DLTRAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQCAVLGFLLLAANALFWNR RLGANYLFISKYPLEILRVIRPFFVYQLLFVSALCLLMLVLYLPFRPSQHGRNQLFVI

Protein Names:Recommended name: Uncharacterized protein TP_0381

Gene Names:Ordered Locus Names:TP_0381

Expression Region:1-238

Sequence Info:full length protein

View full details