Skip to product information
1 of 1

Gene Bio Systems

Recombinant Toxoplasma gondii Profilin(PRF)

Recombinant Toxoplasma gondii Profilin(PRF)

SKU:CSB-YP151074Ba

Regular price ¥208,900 JPY
Regular price Sale price ¥208,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q58NA1

Gene Names: PRF

Organism: Toxoplasma gondii

AA Sequence: SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY

Expression Region: 2-163aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 19.4 kDa

Alternative Name(s):

Relevance:

Reference: A profilin-like protein from Toxoplasma gondii potently triggers dendritic cell IL-12 production through TLR11.Yarovinsky F., Zhang D., Andersen J.F., Bannenberg G.L., Serhan C.N., Hayden M.S., Hieny S., Sutterwala F., Flavell R.A., Ghosh S., Sher A.Skillman K.M., Sibley D. Common inheritance of chromosome Ia associated with clonal expansion of Toxoplasma gondii.Khan A., Bohme U., Kelly K.A., Adlem E., Brooks K., Simmonds M., Mungall K., Quail M.A., Arrowsmith C., Chillingworth T., Churcher C., Harris D., Collins M., Fosker N., Fraser A., Hance Z., Jagels K., Moule S. , Murphy L., O'Neil S., Rajandream M.A., Saunders D., Seeger K., Whitehead S., Mayr T., Xuan X., Watanabe J., Suzuki Y., Wakaguri H., Sugano S., Sugimoto C., Paulsen I., Mackey A.J., Roos D.S., Hall N., Berriman M., Barrell B., Sibley L.D., Ajioka J.W.Genome Res. 16:1119-1125(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details