Skip to product information
1 of 1

Gene Bio Systems

Recombinant TM2 domain-containing protein C41D11.9(C41D11.9)

Recombinant TM2 domain-containing protein C41D11.9(C41D11.9)

SKU:CSB-CF836118CXY

Regular price ¥271,600 JPY
Regular price Sale price ¥271,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q95QZ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ISGTKDVKSKNCDGSAGLTCTFPGDCRIGDTVKVNCTSRKGCPNPVSRNNVEAVCRFCWQ LLPGDYDCEPATNCSTSSTKLLVTKCSAHSSVICMGQRNFYKRIPCNWSSGYSWTKTMIL SVVLGGFGADRFYLGLWKSAIGKLFSFGGLGVWTLVDVVLIAVGYIKPYDGSMYI

Protein Names:Recommended name: TM2 domain-containing protein C41D11.9

Gene Names:ORF Names:C41D11.9

Expression Region:21-195

Sequence Info:full length protein

View full details