Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thiomicrospira crunogena Probable intracellular septation protein A(Tcr_1232)

Recombinant Thiomicrospira crunogena Probable intracellular septation protein A(Tcr_1232)

SKU:CSB-CF656685TAAD

Regular price ¥279,200 JPY
Regular price Sale price ¥279,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thiomicrospira crunogena (strain XCL-2)

Uniprot NO.:Q31G96

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLFDLFPVILFFIAFKLYGIYVATAVAIIASIAQVAYVYAKNKRIEKMHIITLALIVI LGGATLILQDETFIKWKPTVVNWGFALVFLGSHFIGQKPIIRRMMDQAISLPDTAWIKLS YMWIAFFIFSGIANIYVAYQYDTDTWVNFKLFGLMGLTLAFILIQGVYISRFIKSSDLDK NDETEEKVMDSTIETLAEVELDSVVDSKHDSKKS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Tcr_1232

Expression Region:1-214

Sequence Info:full length protein

View full details