Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thiobacillus denitrificans Large-conductance mechanosensitive channel(mscL)

Recombinant Thiobacillus denitrificans Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF659548TAAE

Regular price ¥265,000 JPY
Regular price Sale price ¥265,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thiobacillus denitrificans (strain ATCC 25259)

Uniprot NO.:Q3SG48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFASEFKQFIAKGNAMDLAVGVIIGAAFSKIVASIVDDLIMPIVGAVFGGFDFSNLFIA LGSVPEGVALTLAEVRKAGVPVLAYGNFVTVLLNFLILALIVFIIVRQINRLKRPAPGAA PAAPPEDIVLLREIRDALRQK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Tbd_2455

Expression Region:1-141

Sequence Info:full length protein

View full details