Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermotoga maritima Glycerol-3-phosphate acyltransferase 1(plsY1)

Recombinant Thermotoga maritima Glycerol-3-phosphate acyltransferase 1(plsY1)

SKU:CSB-CF893053TNJ

Regular price ¥277,900 JPY
Regular price Sale price ¥277,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

Uniprot NO.:Q9X109

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNFFLITIQFLSGAVMYSHIIAKIKGIDLRKIRDGNPGSSNLWRAAGWKYGFPALMLDY FKGTFPIAFFVWNESFHVNRYVIAFAALSGILGHAFSPFLKFKGGKAIATTFGAWSVLTK WEGPMVLGTVFTIFSILHRLRGKNKTTPEEDAFRVMIGFAALLIYTMWKVFNGMPELAIL YFGNFLIVFYKHRLELRRYLKGV

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY1 Ordered Locus Names:TM_1283

Expression Region:1-203

Sequence Info:full length protein

View full details