Recombinant Thermosynechococcus elongatus Photosystem I reaction center subunit PsaK(psaK)

SKU: CSB-CF358458TDQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermosynechococcus elongatus (strain BP-1)

Uniprot NO.:P0A425

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TLPDTTWTPSVGLVVILCNLFAIALGRYAIQSRGKGPGLPIALPALFEGFGLPELLATTS FGHLLAAGVVSGLQYAGAL

Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 8.0 kDa polypeptide Photosystem I subunit X

Gene Names:Name:psaK Ordered Locus Names:tsr2273

Expression Region:5-83

Sequence Info:full length protein