Gene Bio Systems
Recombinant Thermococcus gammatolerans UPF0290 protein TGAM_2129 (TGAM_2129)
Recombinant Thermococcus gammatolerans UPF0290 protein TGAM_2129 (TGAM_2129)
SKU:CSB-CF512658TMP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Uniprot NO.:C5A2X0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGALSSMFWALWYILPAYFANASPVLLGGGRPIDGGRKWRDGNRILGDGKTWRGFLGGVS VGTLVGVLQYYLTPAFYGSLKTAVLLAFLLSFGALMGDLVGSFIKRRLNLPRGYPAVGLD QLGFLISALAFAYPVKTISSGQMLFLLIFTPLVHWGANYFAYKMGWKSVPW
Protein Names:Recommended name: UPF0290 protein TGAM_2129
Gene Names:Ordered Locus Names:TGAM_2129
Expression Region:1-171
Sequence Info:full length protein
