Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermoanaerobacter tengcongensis ATP synthase subunit c(atpE)

Recombinant Thermoanaerobacter tengcongensis ATP synthase subunit c(atpE)

SKU:CSB-CF837164TCX

Regular price ¥252,900 JPY
Regular price Sale price ¥252,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Caldanaerobacter subterraneus subsp. tengcongensis)

Uniprot NO.:Q8R5T5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLLAIGAAIAALTGIGAGVGIGIATGKAVEAVSRQPEASGKIMQLLLLGGALAEATAIY GLLVAIMIIIFKP

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:TTE0631

Expression Region:1-73

Sequence Info:full length protein

View full details