
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Uniprot NO.:Q4JQI4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAHPSQLGFQDAASPVMEELLHFHDHALMIVFLISTLVLYIIAATASTKLTDKYILDSQE IEVIWTIMPAVILILIALPSLRILYLMDEINDPHLTVKTMGHQWYWSYEYTDYDDLSFDS YMIPTQDLTPGQFRLLETDHRMVIPVDSPIRVLVSAEDVLHSWAVPSLGIKMDAVPGRLN QTAFIVSRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEDA
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:mt-co2 Synonyms:coii, coxii, mtco2
Expression Region:1-230
Sequence Info:full length protein
You may also like
-
Recombinant Tetraodon nigroviridis Cytochrome c oxidase subunit 3(mt-co3)
- Regular price
- ¥185,300 JPY
- Sale price
- ¥185,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Oncorhynchus mykiss Cytochrome c oxidase subunit 2(mt-co2)
- Regular price
- ¥181,600 JPY
- Sale price
- ¥181,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dinodon semicarinatum Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- ¥181,400 JPY
- Sale price
- ¥181,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Propithecus tattersalli Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- ¥181,200 JPY
- Sale price
- ¥181,200 JPY
- Regular price
-
- Unit price
- per
Sold out