Skip to product information
1 of 1

Gene Bio Systems

Recombinant Taraxacum officinale Root allergen protein

Recombinant Taraxacum officinale Root allergen protein

SKU:CSB-EP528639TLH

Regular price ¥190,500 JPY
Regular price Sale price ¥190,500 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: allergen

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Taraxacum officinale (Common dandelion) (Leontodon taraxacum)

Delivery time: 3-7 business days

Uniprot ID: O49065

AA Sequence: MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEAC

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-157aa

Protein length: Full Length

MW: 37 kDa

Alternative Name(s):

Relevance:

Reference:

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details