Skip to product information
1 of 1

Gene Bio Systems

Recombinant Takifugu rubripes Putative protein 2

Recombinant Takifugu rubripes Putative protein 2

SKU:CSB-CF530360TKY

Regular price ¥273,600 JPY
Regular price Sale price ¥273,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Uniprot NO.:O73698

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSDREGLWMLAAFALMTLFLLDNVGVTQAKSFDDVRCKCICPPYRNISGHIYNRNFTQK DCNCLHVVDPMPVPGNDVEAYCLLCECKYEERSTNTIRVTIIIFLSVVGALLLYMLFLLL VDPLIRKPDPLAQTLHNEEDSEDIQPQMSGDPARGNTVLERVEGAQQRWKKQVQEQRKTV FDRHKML

Protein Names:Recommended name: Putative protein 2 Short name= PUT2

Gene Names:

Expression Region:1-187

Sequence Info:full length protein

View full details