Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tachypleus tridentatus Limulus clotting factor C,partial

Recombinant Tachypleus tridentatus Limulus clotting factor C,partial

SKU:CSB-EP335355TAH

Regular price ¥190,200 JPY
Regular price Sale price ¥190,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P28175

Gene Names: N/A

Organism: Tachypleus tridentatus (Japanese horseshoe crab)

AA Sequence: IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI

Expression Region: 763-1019aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 33.8 kDa

Alternative Name(s):

Relevance: This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.

Reference: "Lipopolysaccharide-sensitive serine-protease zymogen (factor C) of horseshoe crab hemocytes. Identification and alignment of proteolytic fragments produced during the activation show that it is a novel type of serine protease." Tokunaga F., Miyata T., Nakamura T., Morita T., Kuma K., Miyata T., Iwanaga S. Eur. J. Biochem. 167:405-416(1987)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details