Skip to product information
1 of 1

Gene Bio Systems

Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2(nuoK2)

Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2(nuoK2)

SKU:CSB-CF368723SVD

Regular price ¥253,900 JPY
Regular price Sale price ¥253,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

Uniprot NO.:A0LJM1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVPFGHVLLLAGALFGLGVFCAVARRNLIMIVLGVEIMLNAASIAFIGAAARWQSMEGQ AFVLFILAVAATEVSIGLAIIVYAFRRTGSFDPAAYNLMKAGDAMQSFERRGPQ

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2

Gene Names:Name:nuoK2 Ordered Locus Names:Sfum_1938

Expression Region:1-114

Sequence Info:full length protein

View full details