Gene Bio Systems
Recombinant Synechocystis sp. Tic20 family protein (sll1737)
Recombinant Synechocystis sp. Tic20 family protein (sll1737)
SKU:CSB-CF301011SSQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechocystis sp. (strain PCC 6803 / Kazusa)
Uniprot NO.:P73387
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASNSTADGKDRFFSALIYVIPLIDAFMFGGFLLQQFPVLQIIYLPIMPLLQFYYQFPFA SFIIFIVLFMAVVRNNNISHFIRFNAMQAILIGILLSLFGLIVAYVIQPVFGQGLVTETL YNFAFLGALACGFFGIVQSVLGRYAEIPTISDAAYSQVRF
Protein Names:Recommended name: Tic20 family protein
Gene Names:Ordered Locus Names:sll1737
Expression Region:1-160
Sequence Info:full length protein
