Recombinant Synechococcus sp. Photosystem II reaction center protein Z(psbZ)

SKU: CSB-CF642460SAAY

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Uniprot NO.:Q2JXZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMLIFQIALLVLVLYSLLLVVAVPVLFSSASDWSRAKNVILVGSLLWVLMVIGVGVLSFF K

Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z

Gene Names:Name:psbZ Ordered Locus Names:CYA_0090

Expression Region:1-61

Sequence Info:full length protein