Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechococcus sp. Photosystem II reaction center protein H(psbH)

Recombinant Synechococcus sp. Photosystem II reaction center protein H(psbH)

SKU:CSB-CF660172SBAD

Regular price ¥251,300 JPY
Regular price Sale price ¥251,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain CC9902)

Uniprot NO.:Q3AUQ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQRTRLGDLLRPLNSEYGKVVPGWGTTPVMGIFMVLFLVFLLVILQLYNKSLILEGINV NWNGLG

Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H

Gene Names:Name:psbH Ordered Locus Names:Syncc9902_2081

Expression Region:1-66

Sequence Info:full length protein

View full details