Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synaptotagmin-1(snt-1)

Recombinant Synaptotagmin-1(snt-1)

SKU:CSB-CF023029CXY

Regular price ¥316,700 JPY
Regular price Sale price ¥316,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:P34693

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKLDFSSQDEENDEDLTKEFVRDEAPMEETTSEAVKQIATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKDDKK

Protein Names:Recommended name: Synaptotagmin-1 Alternative name(s): Synaptotagmin I

Gene Names:Name:snt-1 ORF Names:F31E8.2

Expression Region:1-441

Sequence Info:full length protein

View full details