Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sus scrofa Interleukin-33(IL33),partial

Recombinant Sus scrofa Interleukin-33(IL33),partial

SKU:CSB-EP011656PI

Regular price ¥164,900 JPY
Regular price Sale price ¥164,900 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: IL33

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: M5B263

AA Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM

Tag info: N-terminal GST-tagged

Expression Region: 123-276aa

Protein length: Partial

MW: 44.6 kDa

Alternative Name(s):

Relevance:

Reference: "cDNA cloning and expression of porcine IL-33."Shimazu T., Tohno M., Kawai Y., Saito T., Kitazawa H.Submitted (FEB-2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details