Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus tokodaii UPF0290 protein STK_04650(STK_04650)

Recombinant Sulfolobus tokodaii UPF0290 protein STK_04650(STK_04650)

SKU:CSB-CF847272FPN

Regular price ¥271,000 JPY
Regular price Sale price ¥271,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)

Uniprot NO.:Q975E2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPIIYYVIFAILYYLPALVANGSAPFVKNGTPIDFRKNFVDGRRLLGDGKTFEGLLVAVT FGTTVGIILAKFLGIYWIYVSFIESLLAMLGDMVGAFIKRRLGLARGARAIGLDQLDFIL GATLALIISKISLNIYEFLSIVVIAFVLHILTNNVAYRLKIKSVPW

Protein Names:Recommended name: UPF0290 protein STK_04650

Gene Names:Ordered Locus Names:STK_04650

Expression Region:1-166

Sequence Info:full length protein

View full details