Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus UPF0290 protein YG5714_1358 (YG5714_1358)

Recombinant Sulfolobus islandicus UPF0290 protein YG5714_1358 (YG5714_1358)

SKU:CSB-CF503054FPF

Regular price ¥270,900 JPY
Regular price Sale price ¥270,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)

Uniprot NO.:C3NE86

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW

Protein Names:Recommended name: UPF0290 protein YG5714_1358

Gene Names:Ordered Locus Names:YG5714_1358

Expression Region:1-166

Sequence Info:full length protein

View full details