Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus UPF0290 protein LS215_1460 (LS215_1460)

Recombinant Sulfolobus islandicus UPF0290 protein LS215_1460 (LS215_1460)

SKU:CSB-CF502509FPB

Regular price ¥270,200 JPY
Regular price Sale price ¥270,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)

Uniprot NO.:C3MQ04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW

Protein Names:Recommended name: UPF0290 protein LS215_1460

Gene Names:Ordered Locus Names:LS215_1460

Expression Region:1-166

Sequence Info:full length protein

View full details