Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98(98)

Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98(98)

SKU:CSB-CF851223FPH

Regular price ¥257,200 JPY
Regular price Sale price ¥257,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) (Sulfolobus virus SIRV-1)

Uniprot NO.:Q8QL14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAITLLEGALYGFFAVTGVLIASFIIGEIVHLYNEKQSNENFAKAIDQMSKSTVTAIESI KDTTVTGINALLNMDTLRDVNSLAREKAKDQNPSSQAK

Protein Names:Recommended name: Uncharacterized protein 98

Gene Names:ORF Names:98

Expression Region:1-98

Sequence Info:full length protein

View full details