Gene Bio Systems
Recombinant Succinate dehydrogenase membrane anchor subunit(SDH4)
Recombinant Succinate dehydrogenase membrane anchor subunit(SDH4)
SKU:CSB-CF301343RJV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Reclinomonas americana
Uniprot NO.:P80482
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTEKLLHFIRTKSGSMHWWLQRFLAILLAPIILYLLFDVAIYIGQQSDPTVMMFLNRIFN HNSIFIFITSVILIWHVRGGMEVIIEDYVHGEKTRIVSIFLIRVIAIEIMEYLYKCSIIF
Protein Names:Recommended name: Succinate dehydrogenase membrane anchor subunit Alternative name(s): Succinate dehydrogenase, subunit IV
Gene Names:Name:SDH4
Expression Region:1-120
Sequence Info:full length protein
