Skip to product information
1 of 1

Gene Bio Systems

Recombinant Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5(ND5)

Recombinant Strongylocentrotus franciscanus NADH-ubiquinone oxidoreductase chain 5(ND5)

SKU:CSB-CF657771SQT-GB

Regular price ¥264,200 JPY
Regular price Sale price ¥264,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Strongylocentrotus franciscanus (Giant red sea urchin)

Uniprot NO.:Q35832

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVINPSLIISTLNLGILAILLGSIFFFSKSYFSNENPSLPINKAASAHLSINNKSEAIEY NSGPFAMAILKALALLSVISLLVAINTEFSDINITLSLWLNNTPTNISLNFIYDQYFLIF LSIALIVTWS

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 5 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 5

Gene Names:Name:ND5

Expression Region:1-130

Sequence Info:full length protein

View full details