Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus uberis UPF0397 protein SUB0313 (SUB0313)

Recombinant Streptococcus uberis UPF0397 protein SUB0313 (SUB0313)

SKU:CSB-CF494451FNR

Regular price ¥272,200 JPY
Regular price Sale price ¥272,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus uberis (strain ATCC BAA-854 / 0140J)

Uniprot NO.:B9DTI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNTSIKTVVAIGIGAALFVIIGLFVPITIFTNTTISLQYAVQALFSVLFGPVAGFFIGF IGHMLKDMFAGYGVWWSWVLPSGLVGLGIGSLKNRLKVDKGIFSKKDILSFNLVQALVNL ISWAIVAPLGDILIYQEPANKVFTQGLFAAFANTFTIGIGGTLLLIAYANSRPKAGSLRK D

Protein Names:Recommended name: UPF0397 protein SUB0313

Gene Names:Ordered Locus Names:SUB0313

Expression Region:1-181

Sequence Info:full length protein

View full details