Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus thermophilus UPF0397 protein stu0306-stu0307(stu0306-stu0307)

Recombinant Streptococcus thermophilus UPF0397 protein stu0306-stu0307(stu0306-stu0307)

SKU:CSB-CF708763SAAD

Regular price ¥274,200 JPY
Regular price Sale price ¥274,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)

Uniprot NO.:Q5M5Y6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNNSIRTVVATGIGAALFIIICIFVNIPIFGNTSIQLQYAVQVLFSVIFGSRSIIGFFM GFIGQVLKDGIQYGDISWAWVLASGITGLVIGLFGKKYDVTMGKFSVMSMIWFNLAQALG LLIAYGVVTPIGDKIQFAQAWSYLYAQSFVAGVANFITIAIGGTLLLAIYASSRTQSGSL TKG

Protein Names:Recommended name: UPF0397 protein stu0306/stu0307

Gene Names:Ordered Locus Names:stu0306/stu0307

Expression Region:1-183

Sequence Info:full length protein

View full details