Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae UPF0397 protein SPT_0523 (SPT_0523)

Recombinant Streptococcus pneumoniae UPF0397 protein SPT_0523 (SPT_0523)

SKU:CSB-CF499308FND

Regular price ¥272,800 JPY
Regular price Sale price ¥272,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain Taiwan19F-14)

Uniprot NO.:C1CPZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD

Protein Names:Recommended name: UPF0397 protein SPT_0523

Gene Names:Ordered Locus Names:SPT_0523

Expression Region:1-182

Sequence Info:full length protein

View full details