Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase(plsY)

Recombinant Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase(plsY)

SKU:CSB-CF499242FNB

Regular price ¥272,900 JPY
Regular price Sale price ¥272,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain JJA)

Uniprot NO.:C1CDJ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTFRILGKKAGMATFVID FFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGKAVATSAGVIFGFAPIF CLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFILSNYDSLFIAIILALASL IIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati

Gene Names:Name:plsY Ordered Locus Names:SPJ_0789

Expression Region:1-213

Sequence Info:full length protein

View full details