Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae 1-acyl-sn-glycerol-3-phosphate acyltransferase(plsC)

Recombinant Streptococcus pneumoniae 1-acyl-sn-glycerol-3-phosphate acyltransferase(plsC)

SKU:CSB-CF817541SMP

Regular price ¥288,700 JPY
Regular price Sale price ¥288,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Uniprot NO.:Q8DNY1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIRYNNNKKTIEGDRMFYTYLRGLVVLLLWSINGNAHYHNTDKIPNQDENYILVAPHRTW WDPVYMAFATKPKQFIFMAKKELFTNRIFGWWIRMCGAFPIDRENPSASAIKYPINVLKK SDRSLIMFPSGSRHSNDVKGGAALIAKMAKVRIMPVTYTGPMTLKGLISRERVDMNFGNP IDISDIKKMNDEGIETVANRIQTEFQRLDEETKQWHNDKKPNPLWWFIRIPALILAIILA ILTIIFSFIASFIWNPDKKREELA

Protein Names:Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase Short name= 1-AGP acyltransferase Short name= 1-AGPAT Short name= 1-acyl-G3P acyltransferase EC= 2.3.1.n4 Alternative name(s): Lysophosphatidic acid acylt

Gene Names:Name:plsC Ordered Locus Names:spr1465

Expression Region:1-264

Sequence Info:full length protein

View full details