Skip to product information
1 of 1

Gene Bio Systems

Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)

Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smal_3977 (Smal_3977)

SKU:CSB-CF467941FLY

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Stenotrophomonas maltophilia (strain R551-3)

Uniprot NO.:B4SNQ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPISILLIGFAMSTDAFAAAIGKGAAMRKPVFRDALRAGIIFGVIEAITPIIGWLLGRA ALQYVEAFDHWIAFGLLGALGIHMIYNGLRPDSAEEDEDPSQHHGFWKLALTGFATSIDA MAVGIGLAFMDVHIGVMAVVIGLCTLTMVTVGIMLGRVLGSMVGKRAEIIGGVILVIIGA TILYEHLHGVA

Protein Names:Recommended name: UPF0059 membrane protein Smal_3977

Gene Names:Ordered Locus Names:Smal_3977

Expression Region:1-191

Sequence Info:full length protein

View full details