Gene Bio Systems
Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0344 protein SSP1805(SSP1805)
Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0344 protein SSP1805(SSP1805)
SKU:CSB-CF672134SBAG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Uniprot NO.:Q49WA9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLHMHIASWVLLIILFFAAYFNFSEKQGASPYFKPIHMLLRLFMLLVLISGFWVWIQSFS SGAAGGHMLLTLKMICGVAVVALMEVTITKRKKGQPSHGLMWTTIVVIILTMIIGIILPM GPITQMFGL
Protein Names:Recommended name: UPF0344 protein SSP1805
Gene Names:Ordered Locus Names:SSP1805
Expression Region:1-129
Sequence Info:full length protein
