
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Uniprot NO.:Q49YR9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKRSDRYKTYNKPNDSNDSNQLHHNTYFKPVNKPQKKKKGKGIILKLLIPILIIIGIIIG VMYALSLRADTDELKNITEKESFVYASDMRDYTKGAFIAMEDERFYKHHGFDVKGTSRAL FSTLSDKSVQGGSTITQQVVKNYYYDNEQSITRKIKELFVAHRVEKEYDKNEILSFYMNN IYYGSDQYTIESAANHYFGVTTDKNNPNLPQISVLQSAILASKINAPSVYNINDMSDNFT NRVKTDLEKMKQQGYISNSQYENAIQELGV
Protein Names:Recommended name: Monofunctional glycosyltransferase Short name= MGT EC= 2.4.-.- Alternative name(s): Peptidoglycan TGase
Gene Names:Name:mgt Ordered Locus Names:SSP0919
Expression Region:1-270
Sequence Info:full length protein
You may also like
-
Recombinant Staphylococcus haemolyticus Monofunctional glycosyltransferase(mgt)
- Regular price
- ¥184,700 JPY
- Sale price
- ¥184,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Monofunctional glycosyltransferase(mgt)
- Regular price
- ¥184,600 JPY
- Sale price
- ¥184,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Monofunctional glycosyltransferase(mgt)
- Regular price
- ¥184,600 JPY
- Sale price
- ¥184,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0421 protein SSP0904(SSP0904)
- Regular price
- ¥191,700 JPY
- Sale price
- ¥191,700 JPY
- Regular price
-
- Unit price
- per
Sold out