Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus haemolyticus UPF0382 membrane protein SH2409(SH2409)

Recombinant Staphylococcus haemolyticus UPF0382 membrane protein SH2409(SH2409)

SKU:CSB-CF680017SBAH

Regular price ¥261,800 JPY
Regular price Sale price ¥261,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus haemolyticus (strain JCSC1435)

Uniprot NO.:Q4L3Q9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFIILGALCTMMSVGTGAFGAHGLEGKLSDKYMSVWEKAVNYQMYHGLGLIIIGVISG TTSINVNWAGWLLFLGVVFFSGSLYILALTQIRILGAITPIGGLLFIAGWLMLIISTFKF VG

Protein Names:Recommended name: UPF0382 membrane protein SH2409

Gene Names:Ordered Locus Names:SH2409

Expression Region:1-122

Sequence Info:full length protein

View full details