
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus haemolyticus (strain JCSC1435)
Uniprot NO.:Q4L4W5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEIIMIFVCGILASISVYLVLSKSLIRIVMGTTLITHASNLFLITMGGLKHGEMPIYEKN ISQYVDPIPHALILTAIVIAFATTAFFLVLAFRTYKELGTDNVERMKGVLDDD
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit C1 Alternative name(s): Mnh complex subunit C1
Gene Names:Name:mnhC1 Ordered Locus Names:SH2001
Expression Region:1-113
Sequence Info:full length protein
You may also like
-
Recombinant Staphylococcus haemolyticus Na(+)-H(+) antiporter subunit F1(mnhF1)
- Regular price
- ¥164,200 JPY
- Sale price
- ¥164,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus haemolyticus Na(+)-H(+) antiporter subunit G1(mnhG1)
- Regular price
- ¥167,000 JPY
- Sale price
- ¥167,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus haemolyticus Na(+)-H(+) antiporter subunit E1(mnhE1)
- Regular price
- ¥171,900 JPY
- Sale price
- ¥171,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus haemolyticus Na(+)-H(+) antiporter subunit B1(mnhB1)
- Regular price
- ¥169,800 JPY
- Sale price
- ¥169,800 JPY
- Regular price
-
- Unit price
- per
Sold out