Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1(yidC1)

Recombinant Staphylococcus epidermidis Membrane protein insertase YidC 1(yidC1)

SKU:CSB-CF692057SAAA

Regular price ¥283,800 JPY
Regular price Sale price ¥283,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Uniprot NO.:Q5HLG6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVK NMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPV LIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYP KDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAK KLKQKLEQNKDNSELLTEES

Protein Names:Recommended name: Membrane protein insertase YidC 1 Alternative name(s): Foldase YidC 1 Membrane integrase YidC 1 Membrane protein YidC 1

Gene Names:Name:yidC1 Ordered Locus Names:SERP2021

Expression Region:19-278

Sequence Info:full length protein

View full details